PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G026223_P04
Common NameLOC100279630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25940.9 Da    PI: 9.6551
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G026223_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.12.7e-29959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien   rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  GRMZM2G026223_P04  9 KRIENPASRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGKLYEFAS 59
                       79***********************************************86 PP

2K-box71.62.3e-2478171699
              K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                        ++++++++ e+ + +++ L k++e L+  +R+llGe Le++s++eL++Le +Leksl  iR +K++ll eq+++l++ke +l++ n++Lr+k
  GRMZM2G026223_P04  78 SNKTAHQDIEQVKADAEGLAKKLEALEAYKRKLLGERLEECSFEELHSLEVKLEKSLHCIRGRKTQLLEEQLHKLKEKEMNLRKSNEDLREK 169
                        444788999**********************************************************************************9 PP

              K-box  98 le 99 
                         +
  GRMZM2G026223_P04 170 CK 171
                        76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.076161IPR002100Transcription factor, MADS-box
SMARTSM004325.8E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-30323IPR002100Transcription factor, MADS-box
CDDcd002651.55E-40375No hitNo description
SuperFamilySSF554553.4E-32381IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.0E-2582171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.66786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MVRGKTQMKR IENPASRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGKLYEFASG  60
SAQKTIERYR TYTKDNVSNK TAHQDIEQVK ADAEGLAKKL EALEAYKRKL LGERLEECSF  120
EELHSLEVKL EKSLHCIRGR KTQLLEEQLH KLKEKEMNLR KSNEDLREKC KKQPPPPPPM  180
LMAPPPPPAP AAIDHTGPKD VGMDVETELY IGLPGRDYRS NNKDMTAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D4e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J4e-19372271Myocyte-specific enhancer factor 2A
3p57_I4e-19372271Myocyte-specific enhancer factor 2A
3p57_D4e-19372271Myocyte-specific enhancer factor 2A
3p57_C4e-19372271Myocyte-specific enhancer factor 2A
3p57_B4e-19372271Myocyte-specific enhancer factor 2A
3p57_A4e-19372271Myocyte-specific enhancer factor 2A
3kov_J4e-19372271Myocyte-specific enhancer factor 2A
3kov_I4e-19372271Myocyte-specific enhancer factor 2A
3kov_B4e-19372271Myocyte-specific enhancer factor 2A
3kov_A4e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.970580.0endosperm| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G026223
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G026223_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9607740.0EU960774.1 Zea mays clone 228490 MADS-box transcription factor 56 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008672798.11e-168PREDICTED: uncharacterized protein LOC100279630 isoform X1
SwissprotQ9XJ601e-117MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLB6T7091e-168B6T709_MAIZE; MADS-box transcription factor 56
STRINGGRMZM2G026223_P041e-168(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-62AGAMOUS-like 20
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]